Call 408.493.1800 | Fax 408.493.1801 | Toll Free 800.891.9699 (US Only) | Email: [email protected]

OryzaExp™ Lactoferrin, Human Recombinant

> 95% pure human recombinant lactoferrin expressed in Oryza Sativa (Rice).
Catalog #: P1403
$345.00

Product Details

Cat # +Size P1403-1
Size 1 g
Alternate Name Recombinant LTF, Plant-derived recombinant lactoferrin
Gene ID 4057
Accession # AAA59511
Source Oryza Sativa (Rice)
Appearance Lyophilized powder
Molecular Weight 80 kDa
Purity by SDS-PAGE > 95% by SDS-PAGE
Endotoxin Level ≤1EU/ug
Reconstitution Instructions Reconstitute in the sterile 0.9% saline or PBS.
Amino Acid Sequence MKLVFLVLLFLGALGLCLAGRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRA DAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLR PFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVA FIRESTVFEDLSDEAERDEYEL
Handling Centrifuge the vial prior to opening.
Storage Conditions -20ºC
Shipping Conditions Gel Pack
USAGE For Research Use Only! Not For Use in Humans.

Details

Lactoferrin (LF), also known as lactotransferrin (LTF), is a globular glycoprotein with a molecular mass of about 80kD, which consists of two highly homologous lobes, designated the N and C lobes. Each LF molecule can reversibly bind two iron molecules. LF functions to transfer iron to the cells and control the level of free iron in the blood and external secretions. It has antibacterial, antiviral, antiparasitic, anti-cancer, anti-allergic and radioprotecting functions and properties. LF can also raise immunocompetence of body.


Why buy BioVision Products?
Innovation
Affordability
Global Presence
Technical Support
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways.
BioVision is committed to providing the highest quality products at a competitive price.
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery.
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently.