Call 408.493.1800 | Fax 408.493.1801 | Toll Free 800.891.9699 (US Only) | Email: [email protected]

New

OryzaExp™ Human Serum Albumin

A human blood plasma protein involved in transport of hormones/fatty acids
Catalog #: P1396

In stock

$355.00

Product Details

Cat # +Size P1396-1
Size 1 g
Alternate Name Albumin
Gene Symbol ALB
Gene ID 213
Accession # AEE60908
Source Rice Grain (Oryza Sativa)
Appearance Lyophilized powder
Physical Form Description Lyophilized
Molecular Weight 66.5 KDa
Purity by SDS-PAGE ≥99% by SDS-PAGE
Endotoxin Level ≤0.125 EU/mg
Reconstitution Instructions Reconstitute in the sterile PBS
Amino Acid Sequence DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCT VATLRETYGEMADCCAKQEPERNECFLQ HKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQR FPKAEFAEVSKLVTDLTKVHTEC
Handling Centrifuge the vial prior to opening.
Storage Conditions 4.0 °C
Shipping Conditions Gel Pack
USAGE For Research Use Only! Not For Use in Humans.

Details

Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca2+, Na+, K+, fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. It is a major zinc transporter in plasma, typically binds about 80% of all plasma zinc.


Why buy BioVision Products?
Innovation
Affordability
Global Presence
Technical Support
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways.
BioVision is committed to providing the highest quality products at a competitive price.
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery.
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently.