Call 408.493.1800 | Fax 408.493.1801 | Toll Free 800.891.9699 (US Only) | Email: [email protected]

Human CellExp™ VEGF110, Human Recombinant

A signaling protein involved in both vasculogenesis and angiogenesis
Catalog #: P1258

In stock

$395.00

Product Details

Cat # +Size P1258-10
Size 10 μg
Alternate Name RP1-261G23.1, MGC70609, MVCD1, VEGFA, VPF
Gene Symbol VEGFA
Gene ID 7422
Accession # P15692
Source HEK293 cells
Appearance Lyophilized
Physical Form Description Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Generally Trehalose is added as a protectant before lyophilization.
Molecular Weight 12.6 kDa
Purity by SDS-PAGE ≥95%
Purity by ≥95%
Endotoxin Level < 1.0 EU per/μg
Reconstitution Instructions Centrifuge the vial prior to opening. Reconstitute in sterile deionized water.
Amino Acid Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR
Handling Centrifuge the vial prior to opening.
Storage Conditions -20°C
Shipping Conditions Gel Pack
USAGE For Research Use Only! Not For Use in Humans.

Details

Vascular endothelial growth factor (VEGF), also known as vascular permeability factor (VPF) and VEGF-A, and is a member of the platelet-derived growth factor (PDGF)/vascular endothelial growth factor (VEGF) family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. Alternatively spliced isoforms of 110,121,145,165,183,189 and 206 amino acids in length are expressed in humans.


Why buy BioVision Products?
Innovation
Affordability
Global Presence
Technical Support
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways.
BioVision is committed to providing the highest quality products at a competitive price.
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery.
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently.
$
Subscribe to our Newsletter!!
and automatically get enrolled into a raffle to win Google Home.
Offer valid for US customers only.