Product Details
Cat # +Size | P1258-10 |
---|---|
Size | 10 μg |
Alternate Name | RP1-261G23.1, MGC70609, MVCD1, VEGFA, VPF |
Gene Symbol | VEGFA |
Gene ID | 7422 |
Accession # | P15692 |
Source | HEK293 cells |
Appearance | Lyophilized |
Physical Form Description | Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Generally Trehalose is added as a protectant before lyophilization. |
Molecular Weight | 12.6 kDa |
Purity by SDS-PAGE | ≥95% |
Purity by | ≥95% |
Endotoxin Level | < 1.0 EU per/μg |
Reconstitution Instructions | Centrifuge the vial prior to opening. Reconstitute in sterile deionized water. |
Amino Acid Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR |
Handling | Centrifuge the vial prior to opening. |
Storage Conditions | -20°C |
Shipping Conditions | Gel Pack |
USAGE | For Research Use Only! Not For Use in Humans. |
Details
![]() |
![]() |
![]() |
![]() |
Innovation |
Affordability |
Global Presence |
Technical Support |
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways. |
BioVision is committed to providing the highest quality products at a competitive price. |
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery. |
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently. |