Call 408.493.1800 | Fax 408.493.1801 | Toll Free 800.891.9699 (US Only) | Email: [email protected]

Human CellExp™ CHI3L3, Mouse Recombinant

Lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine.
Catalog #: P1312

In stock

$265.00

Product Details

Cat # +Size P1312-10
Size 10 µg
Alternate Name Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3
Gene Symbol Chil3
Gene ID 12655
Accession # O35744
Source HEK 293 cells
Appearance Lyophilized
Physical Form Description Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Purity by SDS-PAGE ≥95%
Reconstitution Instructions Reconstitute in sterile deionized water to a concentration of 100 µg/ml.
Amino Acid Sequence YQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHEQDLRDYEALNGLKDKNTELKTLLAIGGWKFGPAS FSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVI KSGYKIPELSQSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILS
Handling Centrifuge the vial prior to opening.
Storage Conditions -20°C
Shipping Conditions Gel Pack
USAGE For Research Use Only! Not to be used in humans

Details

Chitinase 3-like 3 gene, also known as YM1 and ECF-L, encodes a precursor protein with 398 amino acid residues with a 21 residue signal sequence. Chitinase 3-like 3 protein is a lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine. Binding to oligomeric saccharides is much stronger than binding to mono- or disaccharides. Also binds heparin and G1cN oligomers, and is produced primarily by macrophages during inflammation. It has chemotactic activity for T-lymphocytes, bone marrow cells and eosinophils.


Why buy BioVision Products?
Innovation
Affordability
Global Presence
Technical Support
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways.
BioVision is committed to providing the highest quality products at a competitive price.
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery.
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently.