Call 408.493.1800 | Fax 408.493.1801 | Toll Free 800.891.9699 (US Only) | Email: [email protected]

Human CellExp™ CaM Kinase, Human Recombinant

Multidomain scaffolding protein with a role in synaptic transmembrane protein anchoring and ion channel trafficking.
Catalog #: P1320

In stock

$285.00

Product Details

Cat # +Size P1320-10
Size 10 µg
Alternate Name Peripheral plasma membrane protein CASK, Calcium/calmodulin-dependent serine protein kinase, Protein lin-2 homolog, CASK, LIN2
Gene Symbol CASK
Gene ID 8573
Accession # O14936
Source HEK 293 cells
Appearance Liquid
Physical Form Description Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Purity by SDS-PAGE >95%
Reconstitution Instructions N/A
Amino Acid Sequence MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASI CHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALR YCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREP YGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDL
Handling Centrifuge the vial prior to opening.
Storage Conditions -20°C
Shipping Conditions Gel Pack
USAGE For Research Use Only! Not to be used in humans

Details

Peripheral plasma membrane protein CASK is a protein that in humans is encoded by the CASK gene.It belongs to the MAGUK family. CASK / LIN2 contains one guanylate kinase-like domain, two L27 domains, one PDZ (DHR) domain, one protein kinase domain and one SH3 domain. This protein is a multidomain scaffolding protein with a role in synaptic transmembrane protein anchoring and ion channel trafficking. It interacts with the transcription factor TBR1 and binds to several cell-surface proteins including amyloid precursor protein, neurexins and syndecans.Unlike many protein kinases, it does not require a divalent cation such as magnesium for catalytic activity.


Why buy BioVision Products?
Innovation
Affordability
Global Presence
Technical Support
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways.
BioVision is committed to providing the highest quality products at a competitive price.
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery.
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently.