GST-Δ/GSTD2, Active Recombinant (Bombyx mori (Silk moth))

≥98% Pure Bombyx mori recombinant GST-Δ/GSTD2, that plays an important role in detoxification.
Catalog #: 7840 | abID:

Product Details

Cat # +Size 7840-100
Size 100 μg
Alternate Name Glutathione S-Transferase Delta, GSTd2
Gene Symbol GST delta
Gene ID 692521
Accession # Q60GK5
Source E. coli
Appearance Liquid
Physical Form Description 2.0 mg/ml solution in 30% glycerol without additives.
Molecular Weight 26.4 kDa (236 aa, 1-216 aa + His Tag)
Purity by SDS-PAGE ≥95%
Endotoxin Level < 1.0 EU per 1 μg of protein (determined by LAL method).
Biological Activity ≥ 20 U/mg as determined with BioVision’s GST colorimetric activity assay kit, Cat # K263-100.
Amino Acid Sequence MGSSHHHHHHSSGLVPRGSH MTIDLYYVPG SAPCRAVLLT AKALNLNLNLKLVDLHHGEQLKPEYLKLNPQHTVPTLVDDG LSIWESRAIITYLVNKYAKGSSLYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVFAGAPADKAKNEKVQ EALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSLEASDIDFKKYAN VKRWYETVKSTAPGYQEANEKGLEAFKGLV NSMLKK
Handling Centrifuge the vial prior to opening.
Storage Conditions -20°C
Shipping Conditions Gel Pack
USAGE For Research Use Only! Not to be used in humans

Details

Glutathione S-transferase Δ is an enzyme in Bombyx mori (Silk moth) encoded by the GSTd2 gene. GSTs are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into nine classes: alpha, delta, kappa, mu, omega, pi, theta, zeta and microsomal. GSTs play a role in susceptibility to cancer, and other diseases.


Why buy BioVision Products?
Innovation
Affordability
Global Presence
Technical Support
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways.
BioVision is committed to providing the highest quality products at a competitive price.
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery.
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently.