Call 408.493.1800 | Fax 408.493.1801 | Toll Free 800.891.9699 (US Only) | Email: [email protected]

EGF, rat recombinant

A growth factor stimulating cell growth, proliferation, and differentiation by binding to EGFR
Catalog #: 4024
SKU-Size Size Price Qty
4024-20 20 μg
$102.00
4024-100 100 μg
$234.00
4024-1000 1 mg
$1,620.00
More Sizes Get Quote

Product Details

Alternate Name Urogastrone, URG, EGF, epidermal growth factor
Gene Symbol EGF
Gene ID Rn. 6075
Accession # P07522
Source E. coli
Appearance Lyophilized protein
Physical Form Description Lyophilized from PBS, pH 7.4
Molecular Weight 6.151 kDa
Purity by SDS-PAGE ≥98%
Purity by ≥98%
Biological Activity The ED₅₀ as calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of > 1 x 10⁷units/mg.
Reconstitution Instructions Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer.
Amino Acid Sequence NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Handling Centrifuge the vial prior to opening.
Storage Conditions -20°C
Shipping Conditions Gel Pack
USAGE For Research Use Only! Not to be used in humans

Details

Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.


Why buy BioVision Products?
Innovation
Affordability
Global Presence
Technical Support
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways.
BioVision is committed to providing the highest quality products at a competitive price.
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery.
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently.
Teryukova, N.P. et al. (2017) Establishment and characterization of clonal lines with cancer stem- and progenitor-cell properties from monolayer Zajdela hepatoma, Cell Tiss. Biol. (2017) 11: 161.
For more citations of this product click here