Product Details
| Alternate Name | Urogastrone, URG, EGF, epidermal growth factor |
|---|---|
| Gene Symbol | EGF |
| Gene ID | Rn. 6075 |
| Accession # | P07522 |
| Source | E. coli |
| Appearance | Lyophilized protein |
| Physical Form Description | Lyophilized from PBS, pH 7.4 |
| Molecular Weight | 6.151 kDa |
| Purity by SDS-PAGE | ≥98% |
| Purity by | ≥98% |
| Biological Activity | The ED₅₀ as calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of > 1 x 10⁷units/mg. |
| Reconstitution Instructions | Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer. |
| Amino Acid Sequence | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |
| Handling | Centrifuge the vial prior to opening. |
| Storage Conditions | -20°C |
| Shipping Conditions | Gel Pack |
| USAGE | For Research Use Only! Not to be used in humans |
Details
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.
Why buy BioVision Products?
 |
 |
 |
 |
Innovation |
Affordability |
Global Presence |
Technical Support |
BioVision aims to provide our customers innovative tools for accelerating drug discovery and biological research. BioVision offers >8,000 products including the most comprehensive array of assay kits for key targets in Metabolic pathways. |
BioVision is committed to providing the highest quality products at a competitive price. |
We have a broad network of global distributors who are ready to address your research needs and ensure fast delivery. |
Our highly trained Technical Support team provides comprehensive product support and is dedicated to resolving your issues quickly and efficiently. |
Teryukova, N.P. et al. (2017) Establishment and characterization of clonal lines with cancer stem- and progenitor-cell properties from monolayer Zajdela hepatoma, Cell Tiss. Biol. (2017) 11: 161.
For more citations of this product click here
