Recombinant Human Prosurfactant Protein C (His tag) (ab267865)
Key features and details
- Expression system: Mammalian
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Prosurfactant Protein C (His tag)
See all Prosurfactant Protein C proteins and peptides -
Purity
> 90 % SDS-PAGE.
NULL -
Expression system
Mammalian -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL -
Predicted molecular weight
21 kDa -
Amino acids
24 to 58 -
Tags
His tag N-Terminus -
Additional sequence information
Mature chain
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab267865 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: PBS, 6% Trehalose
Lyophilized from.
General Info
-
Alternative names
- BRICD6
- BRICHOS domain containing 6
- PSP C
see all -
Function
Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. -
Involvement in disease
Defects in SFTPC are the cause of pulmonary surfactant metabolism dysfunction type 2 (SMDP2) [MIM:610913]; also called pulmonary alveolar proteinosis due to surfactant protein C deficiency. A rare disease associated with progressive respiratory insufficiency and lung disease with a variable clinical course, due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress.
Genetic variations in SFTPC are a cause of susceptibility to respiratory distress syndrome in premature infants (RDS) [MIM:267450]; also known as RDS in prematurity. RDS is a lung disease affecting usually premature newborn infants. It is characterized by deficient gas exchange, diffuse atelectasis, high-permeability lung edema and fibrin-rich alveolar deposits called 'hyaline membranes'. -
Sequence similarities
Contains 1 BRICHOS domain. -
Cellular localization
Secreted > extracellular space > surface film. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab267865 has not yet been referenced specifically in any publications.