Shopping cart is empty
 
 
Phone: 408-493-1800 | Fax: 408-493-1801
 My Wish List | My Account | Checkout

My Shopping Cart:  0 item(s)

Home » » Proteins and Enzymes » Proteins and Enzymes (A-Z) » 4880-10
Products and Applications 

GMF-beta, human recombinant
A growth and differentiation factor in the vertebrate brain

Catalog# Size Price    
4880-10 10 μg $195.00 Add to Cart
4880-10001 mg$5450.00Add to Cart

Product Image
GMF-beta, human recombinant

Alternate Name/Synonyms: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF, recombinant GMFB, human GMFB

Gene Symbol: GMFB

Accession #: P60983

Gene ID: 2764

Source: E. coli

Appearance: Lyophilized protein

Physical Form Description: Lyophilized after dialysis against 20 mM PBS pH 7.4 and 130 mM NaCl

Molecular Weight: 17.0 kDa

Purity by SDS-PAGE: ≥98%

Purity by HPLC: ≥98%

Endotoxin Level: N/A

Biological Activity: N/A

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers

Storage Temp.: -20°C

Shipping: Blue Ice

Background Information: Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve growth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression.GMF-beta enhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Cell- surface GMF-Beta acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells

Amino Acid Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Handling: Centrifuge the vial prior to opening

USAGE: For Research Use Only! Not For Use in Humans.

Product Toolbox
Product Support


Join Our Community
Promotions
Check out our promotions and get free gifts with your purchase:


Related Literature

Newsletter

Download PDF

Product Catalog

Download PDF

Brochures

Diabetes & Obesity v.2

Download PDF

Stem Cell Research v.3

Download PDF

Metabolism Assay Kits

Download PDF

Protein Extraction

Download PDF

Epigenetics

Download PDF

Apoptosis

Download PDF

Cytokines

Download PDF

Antibodies

Download PDF

Biochemicals

Download PDF

Protease

Download PDF