Alternate Name/Synonyms: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF, recombinant GMFB, human GMFB

Gene Symbol: GMFB

Accession #: P60983

Gene ID: 2764

Source: E. coli

Appearance: Lyophilized protein

Physical Form Description: Lyophilized after dialysis against 20 mM PBS pH 7.4 and 130 mM NaCl

Molecular Weight: 17.0 kDa

Purity by SDS-PAGE: ≥98%

Purity by HPLC: ≥98%

Endotoxin Level: N/A

Biological Activity: N/A

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers

Storage Temp.: -20°C

Shipping: Blue Ice

Background Information: Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve growth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression.GMF-beta enhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Cell- surface GMF-Beta acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells

Amino Acid Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Handling: Centrifuge the vial prior to opening

USAGE: For Research Use Only! Not For Use in Humans.